PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g080490.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 291aa    MW: 31547.3 Da    PI: 8.6229
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g080490.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.11.8e-3258112459
         ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                          rY+eClkNhAa++Gg+++DGCgEfmps geegt +alkCaAC+CHRnFHR+e  +
  Sopim04g080490.0.1  58 GRYRECLKNHAANIGGNVTDGCGEFMPS-GEEGTLEALKCAACNCHRNFHRKEIPN 112
                         69*************************9.999********************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047709.3E-3059110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.8E-3159110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257744.0E-2259110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.71560109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.3E-28215277IPR009057Homeodomain-like
SuperFamilySSF466891.5E-16215276IPR009057Homeodomain-like
TIGRFAMsTIGR015652.3E-28219276IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MALGGGNEEK EMRISGFQNI DLVSPGGAAP DDIVSAAPHN NSTTGSNKLN KGTSTVRGRY  60
RECLKNHAAN IGGNVTDGCG EFMPSGEEGT LEALKCAACN CHRNFHRKEI PNNVGAGVGG  120
GVGGDNNNNA GIMVVHPLQL PQPLPSPIPS LNHHHHHHHQ HGGRSIWTTM PPQPVKMAFG  180
GSGGGSGATD SSSEELNFNT YHHQQATSVP PQQPFMLAKK RFRTKFSQEQ KEKMLEFAEK  240
LGWRIPREDD AEVQRFCSQV GVKRQVFKVW MHNNKNPSSA KKNIIQEDQP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-252202791879ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4578110.0CU457811.8 S.lycopersicum DNA sequence from clone LE_HBa-132M8 on chromosome 4, complete sequence.
GenBankCU4682390.0CU468239.4 S.lycopersicum DNA sequence from clone SL_MboI-124K5 on chromosome 4, complete sequence.
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238289.10.0PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9FRL52e-59ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLK4BVC80.0K4BVC8_SOLLC; Uncharacterized protein
STRINGSolyc04g080490.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.23e-55homeobox protein 31